PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn238851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 279aa    MW: 31515.1 Da    PI: 9.2983
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn238851genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-15132176347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
       Achn238851 132 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 176
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-41469IPR009057Homeodomain-like
PROSITE profilePS512936.2032075IPR017884SANT domain
SMARTSM007171.2E-82173IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-102378IPR009057Homeodomain-like
CDDcd001677.42E-72470No hitNo description
Gene3DG3DSA:1.10.10.603.7E-13122181IPR009057Homeodomain-like
PROSITE profilePS5129420.317125181IPR017930Myb domain
SuperFamilySSF466891.72E-17126180IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-17128180IPR006447Myb domain, plants
SMARTSM007171.9E-13129179IPR001005SANT/Myb domain
CDDcd001673.87E-11132177No hitNo description
PfamPF002494.7E-13132176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEILSPASFL SGSNWLFEEI RSTRWTTAEN KMFEDALAVY DEATPDRWQK VAARIPGKTV  60
WDVMKQYEKL EEDVSSIEAG LIPIPGYCSS PFTLDWGDSH GFDSGFRPSY SPGGKRSSSG  120
RNSEQERKKG VPWTEEEHKL FLMGLKKYGK GDWRNISRNF VTTRTPTQVA SHAQKYFIRQ  180
LSGGKDKRRA SIHDITTVNL HDHQTPSPEH KRPPSPDQPN SAPMPRNHFQ WNQPNSGIGM  240
AFNQTQGNAF ASPCFGINSY VGPQNIFQVQ SGDRWRSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1625901176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016182.11e-143DIV1A protein
RefseqXP_012445667.11e-143PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-127DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A061GWE31e-143A0A061GWE3_THECC; DIV1A protein
TrEMBLA0A0D2TGI11e-143A0A0D2TGI1_G
STRINGPOPTR_0001s25590.11e-141(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-109Homeodomain-like transcriptional regulator